Eternal ResearchStarts here

Join for 10% off + access to COA-backed compounds

Every batch is rigorously tested to guarantee quality.

Eternal Peptides
Card processing is back online! • Automatic stackable 5%–10% discounts are available at checkout for select payment methods. Card processing is back online! • Automatic stackable 5%–10% discounts are available at checkout for select payment methods. Card processing is back online! • Automatic stackable 5%–10% discounts are available at checkout for select payment methods. Card processing is back online! • Automatic stackable 5%–10% discounts are available at checkout for select payment methods. Card processing is back online! • Automatic stackable 5%–10% discounts are available at checkout for select payment methods. Card processing is back online! • Automatic stackable 5%–10% discounts are available at checkout for select payment methods. Card processing is back online! • Automatic stackable 5%–10% discounts are available at checkout for select payment methods. Card processing is back online! • Automatic stackable 5%–10% discounts are available at checkout for select payment methods.
IGF-1 LR3
IGF-1 LR3
IGF-1 LR3
IGF-1 LR3
IGF-1 LR3
thumb
thumb
thumb
thumb
zoom image

Satisfaction
Guaranteed

All products are handled with strict quality standards to ensure consistent research-grade excellence.

Secure
Ordering

Our checkout is SSL encrypted and completely secure.

Third-party
Tested

Our products are verified by independent third party laboratories to meet quality standards.

Batch & Lot
Tracking

All product batches and lots are assigned unique identifiers and tied to publicly posted lab reports.

Endless
Commitment

We are committed to helping our customers. If you have any questions or concerns, please reach out through our Contact Us page.

IGF-1 LR3

Original price was: $100.00.Current price is: $79.99.

Purchase & earn 80 points!
Orders processed within 24 hours · Free shipping on orders over $200

Discount per Quantity

QuantityDiscountPrice
5 - 105%$75.99
11 - 2010%$71.99
21+15%$67.99

Rigorous Third-Party Testing

Every batch of our research chemicals and peptides undergoes
third-party testing.

Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes. Kindly review our Terms & Conditions before making a purchase.

Always quality-tested, verified with third-party COAs

At every step, we prioritize quality by conducting rigorous third-party testing on all our products. These tests focus on five key characteristics — identity, purity, sterility, endotoxin levels, and heavy metal content — ensuring that each product meets the highest standards of quality, with independent third-party Certificates of Analysis (COAs) to verify our commitment to excellence.

Identity Test

Identity testing ensures that the product contains the correct ingredient as labeled, verifying its authenticity and matching it to established reference standards.

Purity Test

Purity and concentration testing verifies that the ingredient is present in the correct amount, with a purity of 99% or higher to meet stringent quality standards.

Sterility Test

Sterility testing ensures that the product is completely free from bacteria, fungi, and other microorganisms.

Endotoxin Test

Endotoxicity testing specifically detects and quantifies lipopolysaccharides (LPS), components of bacterial cell walls, to ensure the product is free from endotoxins.

Heavy Metals Test

Heavy metals testing ensures that the product is free of heavy metals such as lead, arsenic, mercury, cadmium, and other heavy metals.

Identity Test

Identity testing ensures that the product contains the correct ingredient as labeled, verifying its authenticity and matching it to established reference standards.

Purity Test

Purity and concentration testing verifies that the ingredient is present in the correct amount, with a purity of 99% or higher to meet stringent quality standards.

Sterility Test

Sterility testing ensures that the product is completely free from bacteria, fungi, and other microorganisms.

Endotoxin Test

Endotoxicity testing specifically detects and quantifies lipopolysaccharides (LPS), components of bacterial cell walls, to ensure the product is free from endotoxins.

Heavy Metals Test

Heavy metals testing ensures that the product is free of heavy metals such as lead, arsenic, mercury, cadmium, and other heavy metals.

*Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes.Kindly review our Terms & Conditions before making a purchase.

Shop IGF-1 LR3 1mg from Eternal Peptides. IGF-1 LR3 is a recombinant 83-amino-acid peptide supplied as a lyophilized powder. Synthesized to ≥99% purity, with every lot supported by an independent Janoshik COA and full batch traceability. Fast, secure Fedex shipping, free on orders over $200. Sold for research use only. 

IGF-1 LR3 Peptide Characteristics

Property Description
Name IGF-1 LR3 (recombinant IGF-1 analogue; Arg3 substitution, N-terminal 13-aa extension) 
Sequence MFPAMPLLSLFVNPSRGVDEPSFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Weight 9,117.5 g/mol
Molecular Formula C400H625N111O116S9
PubChem CID n/a (CAS: 946870-92-4)
Product Form Lyophilized powder supplied in 1 mg research vials
Purity Typically ≥99%, verified via lot-specific Certificate of Analysis (COA)
Solubility Soluble in sterile water or dilute acetic acid; gentle mixing 
Storage Lyophilized 2-8°C, or at/below -18°C extended; reconstituted 2-8°C 

COA and Quality Assurance

Eternal Peptides provides a lot-specific Certificate of Analysis for every IGF-1 LR3 lot. Each COA documents identity by HPLC and/or mass spectrometry, purity, and, where applicable, sterility and endotoxin levels, plus lot-specific storage guidance. Testing is conducted by independent third-party laboratories including Janoshik. COAs are lot-traceable and available on the Lab Tests page.

Handling and Storage

Store unopened IGF-1 LR3 vials at 36-46°F (2-8°C) for routine laboratory storage or at 0°F (-18°C) or below for longer-term preservation. Keep vials tightly sealed and protected from light, heat, and moisture until needed for research. When preparing a working solution, use an appropriate sterile reconstitution solution or compatible laboratory buffer in accordance with validated laboratory procedures. Prepared solutions may be maintained under refrigerated or frozen conditions as required by the research protocol, with aliquoting commonly used to help preserve sample integrity by minimizing repeated freeze-thaw cycles. Always follow institutional biosafety, laboratory handling, and disposal requirements.

Legal and Regulatory Disclaimer

IGF-1 LR3 is supplied strictly for laboratory research use only. It is not approved for human or veterinary use, clinical administration, therapeutic applications, or diagnostic procedures of any kind. Its safety, efficacy, and appropriate handling in humans or animals have not been established. Purchasers are responsible for compliance with all applicable local, state, and federal laws and institutional biosafety regulations.

Dr. Sony Sherpa, MBBS, MD

Medical author

Dr. Sony Sherpa holds a medical degree (MBBS, MD) and writes on peptide characterisation, chemical and structural data, and laboratory handling and storage. Her focus is on accuracy and fidelity to current published research, with all content presented for laboratory research use only. Read full profile

0