Eternal ResearchStarts here
Join for 10% off + access to COA-backed compounds
Every batch is rigorously tested to guarantee quality.
Join for 10% off + access to COA-backed compounds
Every batch is rigorously tested to guarantee quality.
All products are handled with strict quality standards to ensure consistent research-grade excellence.
Our checkout is SSL encrypted and completely secure.
Our products are verified by independent third party laboratories to meet quality standards.
All product batches and lots are assigned unique identifiers and tied to publicly posted lab reports.
We are committed to helping our customers. If you have any questions or concerns, please reach out through our Contact Us page.
Original price was: $100.00.$79.99Current price is: $79.99.
| Quantity | Discount | Price |
|---|---|---|
| 5 - 10 | 5% | $75.99 |
| 11 - 20 | 10% | $71.99 |
| 21+ | 15% | $67.99 |
Every batch of our research chemicals and peptides undergoes third-party testing.
Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes. Kindly review our Terms & Conditions before making a purchase.
At every step, we prioritize quality by conducting rigorous third-party testing on all our products. These tests focus on five key characteristics — identity, purity, sterility, endotoxin levels, and heavy metal content — ensuring that each product meets the highest standards of quality, with independent third-party Certificates of Analysis (COAs) to verify our commitment to excellence.
*Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes.Kindly review our Terms & Conditions before making a purchase.
Shop IGF-1 LR3 1mg from Eternal Peptides. IGF-1 LR3 is a recombinant 83-amino-acid peptide supplied as a lyophilized powder. Synthesized to ≥99% purity, with every lot supported by an independent Janoshik COA and full batch traceability. Fast, secure USPS shipping, free on orders over $200. Sold for research use only.
| Property | Description |
| Name | IGF-1 LR3 (recombinant IGF-1 analogue; Arg3 substitution, N-terminal 13-aa extension) |
| Sequence | MFPAMPLLSLFVNPSRGVDEPSFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Weight | 9,117.5 g/mol |
| Molecular Formula | C400H625N111O116S9 |
| PubChem CID | n/a (CAS: 946870-92-4) |
| Product Form | Lyophilized powder supplied in 1 mg research vials |
| Purity | Typically ≥99%, verified via lot-specific Certificate of Analysis (COA) |
| Solubility | Soluble in sterile water or dilute acetic acid; gentle mixing |
| Storage | Lyophilized 2-8°C, or at/below -18°C extended; reconstituted 2-8°C |
Eternal Peptides provides a lot-specific Certificate of Analysis for every IGF-1 LR3 lot. Each COA documents identity by HPLC and/or mass spectrometry, purity, and, where applicable, sterility and endotoxin levels, plus lot-specific storage guidance. Testing is conducted by independent third-party laboratories including Janoshik. COAs are lot-traceable and available on the Lab Tests page.
Store unopened IGF-1 LR3 vials at 36-46°F (2-8°C) for routine laboratory storage or at 0°F (-18°C) or below for longer-term preservation. Keep vials tightly sealed and protected from light, heat, and moisture until needed for research. When preparing a working solution, use an appropriate sterile reconstitution solution or compatible laboratory buffer in accordance with validated laboratory procedures. Prepared solutions may be maintained under refrigerated or frozen conditions as required by the research protocol, with aliquoting commonly used to help preserve sample integrity by minimizing repeated freeze-thaw cycles. Always follow institutional biosafety, laboratory handling, and disposal requirements.
IGF-1 LR3 is supplied strictly for laboratory research use only. It is not approved for human or veterinary use, clinical administration, therapeutic applications, or diagnostic procedures of any kind. Its safety, efficacy, and appropriate handling in humans or animals have not been established. Purchasers are responsible for compliance with all applicable local, state, and federal laws and institutional biosafety regulations.
Dr. Sony Sherpa, MBBS, MD
Medical author
Dr. Sony Sherpa holds a medical degree (MBBS, MD) and writes on peptide characterisation, chemical and structural data, and laboratory handling and storage. Her focus is on accuracy and fidelity to current published research, with all content presented for laboratory research use only. Read full profile
